Protein coding transcript 108471

• Transcript: Ll_transcript_410191
• CDS coordinates: 331-1098 (+)
• Peptide sequence: MQGCDASVMLEGNNTEQSDPANRSVGGFSVIESAKRVLEVYCPGTVSCADIIALAARDAVEIVGGPMIPIPTGRRDGMVSLASNVRSNIVDTSFTMDDMINHFSTKGLSLVDLVILSGGHTIGTAHCSSFRNRFKEESNGKFSLIDNNTLDSTYGDELMRKCSSVANPSVTVNNDPQTSMLFDNQYYKNLLSNKGLFQSDSVLINDDRTSKLVGDLANDQDLFFQNWAQSFLKLTNVGVKTGDEGEVRVSCATSK*
• ORF Type: complete

Annotations of Ll_transcript_410191

• Blastp: Peroxidase 18 from Arabidopsis with 62.85% of identity
• Blastx: Peroxidase 18 from Arabidopsis with 62.85% of identity
• Eggnog: peroxidase(ENOG410Y94T)
• Kegg: Link to kegg annotations (AT2G24800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003550235.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;