| Transcript | Ll_transcript_283754 |
|---|---|
| CDS coordinates | 186-560 (+) |
| Peptide sequence | MAAISLRKGNTRLPAEVNRVLYVRNLPFNITSEEMYDIFGKYGAIRQIRIGTNNTRGTAFVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQQAKMSKKFDHKKKEDEITRMQEKYGVSTKDKS* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Splicing factor 3B subunit 6-like protein from Arabidopsis with 87.9% of identity |
| Eggnog | premRNA branch site protein(ENOG4111IHX) |
| Kegg | Link to kegg annotations (AT5G12190) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460440.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer