Protein coding transcript 108498

• Transcript: Ll_transcript_410296
• CDS coordinates: 58-363 (+)
• Peptide sequence: MEGHDLYHHHQRQQQQHQHHNINTTSVNLDVIDRLPQWSIQETKEFLVIREEMDQAFMETKRNKQLWDIISNRMKEKGYLRSSEQCKCKWKNLVTRYKVLC*
• ORF Type: complete

Annotations of Ll_transcript_410296

• Blastp: Trihelix transcription factor GT-3a from Arabidopsis with 68.66% of identity
• Blastx: Trihelix transcription factor GT-3a from Arabidopsis with 68.66% of identity
• Eggnog: Transcription factor(ENOG410YYXY)
• Kegg: Link to kegg annotations (AT5G01380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020206791.1)
• Pfam: Myb/SANT-like DNA-binding domain (PF13837.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;