Protein coding transcript 108499

• Transcript: Ll_transcript_410304
• CDS coordinates: 71-598 (+)
• Peptide sequence: MEPESMRHQFPFYNELQAIFTARIQQMLWSEASEGVSKKKTMQLSSEDEEYVNEESEGDHNNIKGTSRKKKKGKMVTGGGSNNSKGLKEILEEFMRQQMQMEVQWMEAFEAKENERKLKEIEWRKAMEALENERVMNDQRWREREEQRRMREETRAENRDTLITILLNKLTREEI*
• ORF Type: complete

Annotations of Ll_transcript_410304

• Blastp: Trihelix transcription factor GT-3a from Arabidopsis with 46.94% of identity
• Blastx: Trihelix transcription factor GT-3a from Arabidopsis with 45.32% of identity
• Eggnog: Transcription factor(ENOG410YYXY)
• Kegg: Link to kegg annotations (AT5G01380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450758.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;