Protein coding transcript 108534

• Transcript: Ll_transcript_409905
• CDS coordinates: 194-766 (+)
• Peptide sequence: MTTMESLIGLVNRIQRACTVLGDYGGDDNNTFSSLWEALPSVAVVGGQSSGKSSVLESIVGRDFLPRGSGIVTRRPLVLQLHKIESGAQEYAEFLHLPRRKFTDFSFVRTEIQDETDRLTGKTKQISPIPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQPENIVQEIETMVRSYVEKVKGSLSLICSEYI*
• ORF Type: complete

Annotations of Ll_transcript_409905

• Blastp: Dynamin-related protein 1E from Arabidopsis with 84.27% of identity
• Blastx: Dynamin-related protein 1E from Arabidopsis with 84.27% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT3G60190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413869.1)
• Pfam: Dynamin family (PF00350.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;