Transcript | Ll_transcript_409898 |
---|---|
CDS coordinates | 27-539 (+) |
Peptide sequence | MAKWVFFFMEMGLNFCYMFLFFLFCVEQSSGKSSVLESIVGRDFLPRGSGIVTRRPLVLQLHKIESGAEEYAEFLHLPRRKFTDFSLVRAEIQDETDRITGKTKQISPIPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQPENIVQEIETMVRSYVEKVKGSLSLICSEYI* |
ORF Type | complete |
Blastp | Dynamin-related protein 1E from Arabidopsis with 86.15% of identity |
---|---|
Blastx | Dynamin-related protein 1E from Arabidopsis with 86.15% of identity |
Eggnog | Dynamin family(COG0699) |
Kegg | Link to kegg annotations (AT3G60190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450038.1) |
Pfam | Dynamin family (PF00350.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer