Protein coding transcript 108578

• Transcript: Ll_transcript_408560
• CDS coordinates: 77-409 (+)
• Peptide sequence: MIVSYFIVTNNEIKKWLCGLLMLFRNPEEIPWAESGAEIIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKPELDIISNASCTTNCLAHLAKVIND
• ORF Type: 3prime_partial

Annotations of Ll_transcript_408560

• Blastp: Glyceraldehyde-3-phosphate dehydrogenase, cytosolic from Pisum with 93.1% of identity
• Blastx: Glyceraldehyde-3-phosphate dehydrogenase, cytosolic from Pisum with 93.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020211226.1)
• Pfam: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;