Transcript | Ll_transcript_408560 |
---|---|
CDS coordinates | 77-409 (+) |
Peptide sequence | MIVSYFIVTNNEIKKWLCGLLMLFRNPEEIPWAESGAEIIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKPELDIISNASCTTNCLAHLAKVIND |
ORF Type | 3prime_partial |
Blastp | Glyceraldehyde-3-phosphate dehydrogenase, cytosolic from Pisum with 93.1% of identity |
---|---|
Blastx | Glyceraldehyde-3-phosphate dehydrogenase, cytosolic from Pisum with 93.1% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020211226.1) |
Pfam | Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer