Protein coding transcript 108607

• Transcript: Ll_transcript_408549
• CDS coordinates: 837-1445 (+)
• Peptide sequence: MGVALTLCTLPGQVTSDRLGPTKMELGLGIHGEPGAAVVDLQPVDVVISHVLKEILSTETNYVPITRGGRVVLLVNGLGSTPLMELMIVAGKAVPKLQLEHGLAVDRVYTGSFMTSIDMTGFSISIMSADPPILQRLDAATKAPYWPVAVDGNRPPAKIPIPLPSSRLAKSDEPRSRPLQINEQGQILEAAIEAAANAILNLK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_408549

• Blastp: Putative 3,4-dihydroxy-2-butanone kinase from Lycopersicon with 77.34% of identity
• Blastx: Putative 3,4-dihydroxy-2-butanone kinase from Lycopersicon with 86.9% of identity
• Eggnog: Dihydroxyacetone kinase(COG2376)
• Kegg: Link to kegg annotations (544126)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433182.1)
• Pfam: Dak1 domain (PF02733.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;