Transcript | Ll_transcript_408533 |
---|---|
CDS coordinates | 223-1053 (+) |
Peptide sequence | MAFPAKKLIGDPINVVTEFIDGLVETYPGLQYLDGFPQVKVVLRADVPYATYDKVAVISGGGSGHEPTHAGFVGEGMLTAAICGDVFSSPPVDSILAGIRAVTGPMGCLLIVKNYTGDRLNFGLAAEQAKSEGYKVETVIVGDDCALPPPRGIAGRRGLAGTILVHKVAGAAAAAGLSLADVAAEAKSASEKVGTMGVALTVCTLPGQVTSDRLGPGKMELGLGIHGEPGAAVADLQPVDVVISHVLKEILSTVCHNMSGGLLAELYGLTVNKMLS* |
ORF Type | complete |
Blastp | Putative 3,4-dihydroxy-2-butanone kinase from Lycopersicon with 89.68% of identity |
---|---|
Blastx | Putative 3,4-dihydroxy-2-butanone kinase from Lycopersicon with 89.68% of identity |
Eggnog | Dihydroxyacetone kinase(COG2376) |
Kegg | Link to kegg annotations (544126) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431365.1) |
Pfam | Dak1 domain (PF02733.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer