Protein coding transcript 108635

• Transcript: Ll_transcript_409597
• CDS coordinates: 135-716 (+)
• Peptide sequence: MEGSGENWPCDSDLDVGDYVKDLYFDVDDESDHNTRRRNQEFSERLLALSDTIPGLNKRMDNTSILDKASNYVKQLQQRVRELEQVESKSGTSSCTEVKSYYYYEGNDNIIPEIRVRVLHKEVLIIIHCEKQKGIMVKIMSHLENLHLSIVNSSVLPFGKSTLDITIIAQMGDRYKRTIDEVVKSLRLVILTK*
• ORF Type: complete

Annotations of Ll_transcript_409597

• Blastp: Transcription factor NAI1 from Arabidopsis with 38.46% of identity
• Blastx: Transcription factor NAI1 from Arabidopsis with 38.46% of identity
• Eggnog: Transcription factor(ENOG41118GE)
• Kegg: Link to kegg annotations (AT2G22770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431912.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;