| Transcript | Ll_transcript_347859 |
|---|---|
| CDS coordinates | 2-328 (+) |
| Peptide sequence | KHRMENGYHIYSFSGQLLREEPIEQFKQFVWRPRPERLLSKEEMKTVRKNLREYSRTFDEADLAKRSSADKAVVEERRRKLNEWLAYRERTVEDLLDERHELRLPEISN |
| ORF Type | internal |
| Blastp | Eukaryotic translation initiation factor 3 subunit B from Sclerotinia with 61.9% of identity |
|---|---|
| Blastx | Eukaryotic translation initiation factor 3 subunit B from Botrytis with 67.05% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SS1G_04820) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016180275.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer