Protein coding transcript 108708

• Transcript: Ll_transcript_409255
• CDS coordinates: 417-860 (+)
• Peptide sequence: MYFHYYGQLLHQQNMLQDYVRTGTYYAAVVENRADFMGRVVVDVGAGSGILSLFAAQAGAKHVYAVEASEMAEYAQKLIAGNPTLAQRITVIKGKVEDVELPEKADVLISEPMGTLLVNERMLESYVIARDRFLTPNGKMFPAVGRIH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_409255

• Blastp: Probable histone-arginine methyltransferase 1.3 from Arabidopsis with 90.54% of identity
• Blastx: Probable histone-arginine methyltransferase 1.3 from Arabidopsis with 79.8% of identity
• Eggnog: Coactivator-associated arginine methyltransferase 1(ENOG410XPDD)
• Kegg: Link to kegg annotations (AT3G06930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437799.1)
• Pfam: Methyltransferase small domain (PF05175.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;