Protein coding transcript 108750

• Transcript: Ll_transcript_409970
• CDS coordinates: 1578-2516 (+)
• Peptide sequence: MAERVVGTGSFGIVFQAKCMETGEAVAIKKVLQDRRYKNRELQLMRLMDHQNVVSLRHCFFSTTSRDELFLNLVMEYVPETMYRVLKHYSSMNQRMPLVYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGETNISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENQVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQVKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTHPFFDELREPNVRLPNGRPLPPLFNFKQEVCI*
• ORF Type: complete

Annotations of Ll_transcript_409970

• Blastp: Shaggy-related protein kinase iota from Arabidopsis with 93.55% of identity
• Blastx: Shaggy-related protein kinase iota from Arabidopsis with 93.65% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G06390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430166.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;