| Transcript | Ll_transcript_432015 |
|---|---|
| CDS coordinates | 3-347 (+) |
| Peptide sequence | KSGKQAVDEVAKRVVTRGSLRPKETNNGELKSPCHRFRSPVASTAKKRSFWDITTTNSPSVATLNGRKTRSHAISEPTTAPPPRSSRLLQPGFARQRFNIYSYSGRDRRGTCQNT |
| ORF Type | internal |
| Blastp | Kinesin-like protein KIN-8A from Arabidopsis with 63.53% of identity |
|---|---|
| Blastx | Kinesin-like protein KIN-8A from Arabidopsis with 63.53% of identity |
| Eggnog | Kinesin family member(COG5059) |
| Kegg | Link to kegg annotations (AT1G18550) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451924.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer