Protein coding transcript 108816

• Transcript: Ll_transcript_409059
• CDS coordinates: 2641-2958 (+)
• Peptide sequence: MEAGKQKDNDRRDDVQSGLNRITMPLVTRSILEVVIPEYAVPKLIARSKSKLAQISELSGANVTLVEDRPDVTQKIIQLSGTPEQAERAQSLLQGFILSTQEDGP*
• ORF Type: complete

Annotations of Ll_transcript_409059

• Blastp: RNA-binding KH domain-containing protein RCF3 from Arabidopsis with 65.69% of identity
• Blastx: RNA-binding KH domain-containing protein RCF3 from Arabidopsis with 54% of identity
• Eggnog: mRNA transport(ENOG410XNN8)
• Kegg: Link to kegg annotations (AT5G53060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437353.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;