Protein coding transcript 108829

• Transcript: Ll_transcript_409050
• CDS coordinates: 290-667 (+)
• Peptide sequence: MEASSSNTTAPATETSTIYQNAQTVAATVLPSKMETGGSSAETGKQKGNERHDDVPSGLNRITMPSVTRSILEVVLPEYAVPRLIARSKSKLAQISELSGANVTLVEDRPDVIHKIVQLSGTPEQA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_409050

• Blastp: RNA-binding KH domain-containing protein RCF3 from Arabidopsis with 50.39% of identity
• Blastx: RNA-binding KH domain-containing protein RCF3 from Arabidopsis with 43.82% of identity
• Eggnog: mRNA transport(ENOG410XNN8)
• Kegg: Link to kegg annotations (AT5G53060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416108.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;