Transcript | Ll_transcript_410794 |
---|---|
CDS coordinates | 2890-3534 (+) |
Peptide sequence | MNVLTRVSGLITNAPFMLNVDCDMYVNNPNIIQHAMCILLDSIGDKEVAFVQCPQQFYGGLKDDPFDNQMVVMFKYIGAGLAGLQGPFYGGTNCFHRRKVIYGLSPYNIEKGNIISEKELKQKFGGSEELVKSVADALEGRSYSPHDDINVSNTLEAASEVASCGYEYANGWGQQVCKRNITYVRLPKAILFYIYSFGITCIKTHLLTNMYKIT* |
ORF Type | complete |
Blastp | Cellulose synthase-like protein H1 from Oryza sativa with 52.84% of identity |
---|---|
Blastx | Cellulose synthase-like protein H1 from Oryza sativa with 53.95% of identity |
Eggnog | Glycosyl transferase, family 2(COG1215) |
Kegg | Link to kegg annotations (4348359) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453798.1) |
Pfam | Cellulose synthase (PF03552.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer