Protein coding transcript 10898

• Transcript: Ll_transcript_283545
• CDS coordinates: 1015-1326 (+)
• Peptide sequence: MLIFYLQNVADRVCLGLIPSSESSWVTAVRALRIEGGILHVHGNTKDSEEPEWIDHVSSSIYEIAKSEGYCWEVSIEHVERVKWYAPHIRHVVADVRCRHIQR*
• ORF Type: complete

Annotations of Ll_transcript_283545

• Blastp: tRNA wybutosine-synthesizing protein 2/3/4 from Arabidopsis with 68.82% of identity
• Blastx: tRNA wybutosine-synthesizing protein 2/3/4 from Arabidopsis with 64.42% of identity
• Eggnog: tRNA-yW synthesizing protein 3 homolog (S. cerevisiae)(COG1590)
• Kegg: Link to kegg annotations (AT4G04670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462817.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;