Protein coding transcript 108988

• Transcript: Ll_transcript_410803
• CDS coordinates: 3091-3933 (+)
• Peptide sequence: MLNVDCDMYVNNPNIIQHAMCILLDSIGDKEVAFVQCPQQFYGGLKDDPFDNQMVVMFKYIGAGLAGLQGPFYGGTNCFHRRKVIYGLSPYNIEKGNIISEKELKQKFGGSEELVKSVADALEGRSYSPHDDINVSNTLEAASEVASCGYEYANGWGQQVGWIYGSITEDVQTGLTIHRKGWRSEMCTPNPIGFTGCAPIGLPTAMTQQKRWVTGMVEIFFSRHCPILATLFGNLPFRMFLAYMWIIDWGLRSLPQTCYVSLLTYCIITNSNFLPKVCII*
• ORF Type: complete

Annotations of Ll_transcript_410803

• Blastp: Cellulose synthase-like protein H1 from Oryza sativa with 49.82% of identity
• Blastx: Cellulose synthase-like protein H1 from Oryza sativa with 51.21% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (4348359)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453797.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;