Transcript | Ll_transcript_408095 |
---|---|
CDS coordinates | 3-731 (+) |
Peptide sequence | ILYAFDQPMNSTLIVTTTVQMPFLKSLNRHITAPPHNLLLLRRNNLKYVVASYNNSSHCISTSFASAPSSRSLCAFSSLLRRTPFLLRCVSSSDASFASSAGGGNSGGGVSGGSGGGGGGSGGDYGDGSGKLVVDAAVQDLSEVSADVIILDVSGMVCGGCAANVKRILESQPQVSSASVNLTTETAIVWPVSEAKTAPNWKKQLGEELAQHLTGCGFNSSLRVQAYYVENFNWEQQKQLPF* |
ORF Type | 5prime_partial |
Blastp | Copper-transporting ATPase PAA1, chloroplastic from Arabidopsis with 70.45% of identity |
---|---|
Blastx | Copper-transporting ATPase PAA1, chloroplastic from Arabidopsis with 70.45% of identity |
Eggnog | p-type ATPase(COG2217) |
Kegg | Link to kegg annotations (AT4G33520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461307.1) |
Pfam | Heavy-metal-associated domain (PF00403.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer