Protein coding transcript 109044

• Transcript: Ll_transcript_408100
• CDS coordinates: 3-554 (+)
• Peptide sequence: ILYAFDQPMNSTLIVTTTVQMPFLKSLNRHITAPPHNLLLLRRNNLKYVVASYNNSSHCISTSFASAPSSRSLCAFSSLLRRTPFLLRCVSSSDASFASSAGGGNSGGGVSGGSGGGGGGSGGDYGDGSGKLVVDAAVQDLSEVSADVIILDVSGMVCGGCAANVKRILESQVSCSNFVFDLI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_408100

• Blastp: Copper-transporting ATPase PAA1, chloroplastic from Arabidopsis with 75% of identity
• Blastx: Copper-transporting ATPase PAA1, chloroplastic from Arabidopsis with 70.91% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT4G33520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461307.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;