Protein coding transcript 109121

• Transcript: Ll_transcript_409135
• CDS coordinates: 194-673 (+)
• Peptide sequence: MTRNIQCREMIEDVQRQVAGLSFQDNRNTSAFNGNYPSVGHQNQRPNAQQTDTRPQTPYYQPSEQPPVSGYGHAPNPYGPGPAHQPPPPYHIPQTSGASYPPPPQAHHPQASHDYGQPAYPGWRGPYYNGQAQHQQQQPASAPQPPYTAQSPYPPHQSGY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_409135

• Blastp: Vacuolar-sorting protein BRO1 from Arabidopsis with 50% of identity
• Blastx: Vacuolar-sorting protein BRO1 from Arabidopsis with 55.43% of identity
• Eggnog: Rhophilin, Rho GTPase binding protein(ENOG410XQX6)
• Kegg: Link to kegg annotations (AT1G15130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456175.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;