Transcript | Ll_transcript_410611 |
---|---|
CDS coordinates | 2-442 (+) |
Peptide sequence | TTHTQAMYAQSSVAVGMKGATKAMAAMNKQMAPAKQLKIMQEFQKQSAQFDMTAEMMSYAIDDVLDSDEVEEETEELTNQVFGTRMGTEDPCSRKREYTRSFILVHLLVHRRLRPVLLQHKRFSTKNYELQLQYLTPRFLCTLHTP* |
ORF Type | 5prime_partial |
Blastp | Vacuolar protein sorting-associated protein 2 homolog 2 from Arabidopsis with 73.17% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 2 homolog 2 from Arabidopsis with 73.17% of identity |
Eggnog | Charged multivesicular body protein(COG5491) |
Kegg | Link to kegg annotations (AT5G44560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426723.1) |
Pfam | Snf7 (PF03357.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer