Protein coding transcript 109237

• Transcript: Ll_transcript_408961
• CDS coordinates: 76-492 (+)
• Peptide sequence: MTELQTNHETAPATAPVDPDPPLTEAPPVAAAVHEKAVAPPPPAPVPVEEAKALAIVEKEKIPDPVPVHKKGSLDRDIALAEVEKEKRLSYVKAWEESEKSKAENKAQKQLSAVAAWENSKKAALEADLRKIEVILNL*
• ORF Type: complete

Annotations of Ll_transcript_408961

• Blastp: Remorin from Solanum with 56.45% of identity
• Blastx: Remorin from Solanum with 78.46% of identity
• Eggnog: Remorin family(ENOG410YI71)
• Kegg: Link to kegg annotations (102577743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456296.1)
• Pfam: Remorin, N-terminal region (PF03766.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;