Protein coding transcript 109241

• Transcript: Ll_transcript_408970
• CDS coordinates: 506-880 (+)
• Peptide sequence: MWPTDIALAEVEKEKRLSYVKAWEESEKSKAENKAQKQLSAVAAWENSKKAALEADLRKIEEQMEKKKAEYGEKMKNKIASVHKQAEEKRAMVEAKRGEEFLKAEELAAKFRATGTTPKKHIGCF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_408970

• Blastp: Remorin from Solanum with 76.03% of identity
• Blastx: Uncharacterized protein At3g61260 from Arabidopsis with 71.9% of identity
• Eggnog: Remorin family(ENOG410YI71)
• Kegg: Link to kegg annotations (102577743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456296.1)
• Pfam: Remorin, C-terminal region (PF03763.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;