| Transcript | Ll_transcript_408950 |
|---|---|
| CDS coordinates | 76-501 (+) |
| Peptide sequence | MTELQTNHETAPATAPVDPDPPLTEAPPVAAAVHEKAVAPPPPAPVPVEEAKALAIVEKEKIPDPVPVHKKGSLDRDIALAEVEKEKKLSYVKAWEESEKSKAENKAQKQLSAVAAWENSKKATLEAELKKIEVIHNLLLS* |
| ORF Type | complete |
| Blastp | Remorin from Solanum with 57.26% of identity |
|---|---|
| Blastx | Remorin from Solanum with 66.25% of identity |
| Eggnog | Remorin family(ENOG410YI71) |
| Kegg | Link to kegg annotations (102577743) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413951.1) |
| Pfam | Remorin, N-terminal region (PF03766.12) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer