Protein coding transcript 109245

• Transcript: Ll_transcript_408955
• CDS coordinates: 446-877 (+)
• Peptide sequence: MIIMVLQSIFLPKQLTYVFLWPTDIALAEVEKEKKLSYVKAWEESEKSKAENKAQKQLSAVAAWENSKKATLEAELKKIEEQLEKKKAEYGEKMKNKIASVHKVAEEKRAMVEAKRGEELLKAEELAAKFRATGTTPKKHIGCF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_408955

• Blastp: Remorin from Solanum with 78.51% of identity
• Blastx: Remorin from Arabidopsis with 74.38% of identity
• Eggnog: Remorin family(ENOG410YI71)
• Kegg: Link to kegg annotations (102577743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456296.1)
• Pfam: Remorin, C-terminal region (PF03763.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;