Protein coding transcript 109252

• Transcript: Ll_transcript_409769
• CDS coordinates: 503-1018 (+)
• Peptide sequence: MDAETLSTTNHLPGFLHRSLPAVVPTLLISVGYVDPGKWAATVEGGARFGFDLMAFMLIFNFAAIFCQYMSAKIGIITGKDLAQICSDEYDTWTCMLLGIQAEVSVIMLDLNMILGMAQGLNLVFGWDLVTCVFLTATGAVFHLLLALLLALYCFLLYLEYSSTNQEFLYS*
• ORF Type: complete

Annotations of Ll_transcript_409769

• Blastp: Ethylene-insensitive protein 2 from Arabidopsis with 58% of identity
• Blastx: Ethylene-insensitive protein 2 from Arabidopsis with 60.71% of identity
• Eggnog: H( )-stimulated, divalent metal cation uptake system (By similarity)(COG1914)
• Kegg: Link to kegg annotations (AT5G03280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425559.1)
• Pfam: Natural resistance-associated macrophage protein (PF01566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;