Transcript | Ll_transcript_408423 |
---|---|
CDS coordinates | 2257-2562 (+) |
Peptide sequence | MLAVLQVYSNLEGNRSHAVNTAWAMLALIGAEQATRDPTPLHRAAVCLINSQMENGDFPQQEIMGVFNKNCMITYAAYRNIFPIWALGEYRCHVLQKQASS* |
ORF Type | complete |
Blastp | Cycloartenol synthase from Glycyrrhiza with 87.1% of identity |
---|---|
Blastx | Cycloartenol synthase from Glycyrrhiza with 87.1% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458558.1) |
Pfam | Squalene-hopene cyclase C-terminal domain (PF13243.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer