Protein coding transcript 109300

• Transcript: Ll_transcript_408434
• CDS coordinates: 1313-1624 (+)
• Peptide sequence: MFYSYVECTSAAIQALASFQKLYPGHRREEIACCIKKAVAFIEKIQASDGSWFAPPSWKTTFFISFSVDLVYKVLKIFLYVYMHLKFSLPNFFAAFTFACVWN*
• ORF Type: complete

Annotations of Ll_transcript_408434

• Blastp: Cycloartenol synthase from Glycyrrhiza with 75% of identity
• Blastx: Cycloartenol synthase from Glycyrrhiza with 89.4% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003610947.1)
• Pfam: Prenyltransferase and squalene oxidase repeat (PF00432.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;