Protein coding transcript 109301

• Transcript: Ll_transcript_408437
• CDS coordinates: 1129-1434 (+)
• Peptide sequence: MLAVLQVYSNLEGNRSHAVNTAWAMLALIGAEQATRDPTPLHRAAVCLINSQMENGDFPQQEIMGVFNKNCMITYAAYRNIFPIWALGEYRCHVLQKQASS*
• ORF Type: complete

Annotations of Ll_transcript_408437

• Blastp: Cycloartenol synthase from Glycyrrhiza with 87.1% of identity
• Blastx: Cycloartenol synthase from Glycyrrhiza with 87.64% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458558.1)
• Pfam: Squalene-hopene cyclase C-terminal domain (PF13243.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;