Protein coding transcript 109373

• Transcript: Ll_transcript_410745
• CDS coordinates: 740-1489 (+)
• Peptide sequence: MHNLRQYEVPLHRYTALMDLQERNERLFYKLLIDNVEELLPIVYTPTVGEACQKYGSIYKRPQGLYISLKEKGKILEVLKNWPEKTVQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSSCLPITIDVGTNNEKLLNDEFYIGLKQKRATGKEYEELLEEFMSAVKKNYGEKVLVQFEDFANHNAFTLLEKYSSSHLVFNDDIQGTASVVLAGVIASLKLIGGTLADHTFLFLGAGEVNV*
• ORF Type: complete

Annotations of Ll_transcript_410745

• Blastp: NADP-dependent malic enzyme from Phaseolus with 91.09% of identity
• Blastx: NADP-dependent malic enzyme from Phaseolus with 85.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000735)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438433.1)
• Pfam: Malic enzyme, N-terminal domain (PF00390.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;