Transcript | Ll_transcript_410417 |
---|---|
CDS coordinates | 1046-1777 (+) |
Peptide sequence | MKPGPLKTDLHLDNIDDINYSFLQEKHFDDNQPLDHTFVGSASTIYNTAFSNSYMTQLDYHPFTLNQNLDHNIIGYDSDLIGQIDFNQHHNPEIKDSESTEFIFDEGFDCSQFFGEDDAGNGGEEVIPNILPNICPPPSAFLSPKCALWDCFRPAQGLTYCLDYCSSGHELLANNEGLPGTTPILRPGGIDVKDGPLLAAVRAKTQGKEVGIPKCEGAASTKSPWNAPGEYAIGLFLFMHLTF* |
ORF Type | complete |
Blastp | Transcription factor VOZ1 from Arabidopsis with 68.63% of identity |
---|---|
Blastx | Transcription factor VOZ1 from Arabidopsis with 77.95% of identity |
Eggnog | one zinc finger protein(ENOG410YAZS) |
Kegg | Link to kegg annotations (AT1G28520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413456.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer