Transcript | Ll_transcript_435523 |
---|---|
CDS coordinates | 2-316 (+) |
Peptide sequence | GGSTIGAPEYCHANFTKYFTAVFWSDRRFSETFSGRRPCYFNTGVMVIDLGRWRRVRYTRKIEKWMEIQKSHRIYELGSLPPFLLVFAGHVAPIEHRWNQHGLGG |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Probable galacturonosyltransferase-like 7 from Arabidopsis with 85.71% of identity |
Eggnog | glycosyltransferase 8 domain containing(ENOG41106K3) |
Kegg | Link to kegg annotations (AT3G62660) |
CantataDB | Link to cantataDB annotations (CNT0000280) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428109.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer