| Transcript | Ll_transcript_435523 |
|---|---|
| CDS coordinates | 2-316 (+) |
| Peptide sequence | GGSTIGAPEYCHANFTKYFTAVFWSDRRFSETFSGRRPCYFNTGVMVIDLGRWRRVRYTRKIEKWMEIQKSHRIYELGSLPPFLLVFAGHVAPIEHRWNQHGLGG |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Probable galacturonosyltransferase-like 7 from Arabidopsis with 85.71% of identity |
| Eggnog | glycosyltransferase 8 domain containing(ENOG41106K3) |
| Kegg | Link to kegg annotations (AT3G62660) |
| CantataDB | Link to cantataDB annotations (CNT0000280) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428109.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer