Protein coding transcript 109506

• Transcript: Ll_transcript_296286
• CDS coordinates: 1-384 (+)
• Peptide sequence: VNVLTHIADVELKHKSILAIDKLKLKHLEQDKRELFRDDQEGETNIGVLSNSSSRVDGLSYGQELKDIENVKSNQENSDIGEDASDGALWDIFRRQDVPKLQELKDIENVKSNQENSDIGEDASDGAL
• ORF Type: internal

Annotations of Ll_transcript_296286

• Blastp: Lysine-specific demethylase JMJ25 from Arabidopsis with 37.25% of identity
• Blastx: Lysine-specific demethylase JMJ25 from Arabidopsis with 37.25% of identity
• Eggnog: lysine (K)-specific demethylase(ENOG410XTAA)
• Kegg: Link to kegg annotations (AT3G07610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452598.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;