Protein coding transcript 109507

• Transcript: Ll_transcript_296287
• CDS coordinates: 1969-2661 (+)
• Peptide sequence: MGPKTCIAYGVSQELGRGDSVTKLHCDMSDAVNVLIHIANVELVHSSLTAIDKLKLKHLEQDKRELLRDDQEGEGSDGVRSSSSSTVDGLSYGSELKDDEKVKTKQENSMFNGKDASDGALWDIFRRQDVPKLQEYLKKHFREFRHVHCRPLNQVIHPIHDQTMYLTEEHKKKLKEEYGIEPWTFIQKLGDAVFIPTGCPHQVRNLKVNLTCMVDLFHLQCTYDCMPASV*
• ORF Type: complete

Annotations of Ll_transcript_296287

• Blastp: Lysine-specific demethylase JMJ25 from Arabidopsis with 40.12% of identity
• Blastx: Lysine-specific demethylase JMJ25 from Arabidopsis with 49.36% of identity
• Eggnog: lysine (K)-specific demethylase(ENOG410XTAA)
• Kegg: Link to kegg annotations (AT3G07610)
• CantataDB: Link to cantataDB annotations (CNT0002033)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441694.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;