Transcript | Ll_transcript_296299 |
---|---|
CDS coordinates | 856-1782 (+) |
Peptide sequence | MRKAASREDSSDNWLYCPRAVDLQPVDLKHFQWHWNNGEPVIVSNVLECTSGLSWEPLVMWRAFRQITNTKHGQHLDVKVLDCLDWCEGEINIHQFFTGYTEGRYDWCDWPQILKLKDWPPSNLFEERLPRHCAEFISSLPYKEYTDPLRGALNLAVKLPTGCLKPDMGPKTYIAYGVAQELGRGDSVTKLHCDMSDAVNVLTHIADVELKHKSILAIDKLKLKHLEQDKRELFRDDQEGETNVGMPTSSSSTVDCLSNGSELEDVEKVKMKHENIMSIGDDASDGALWDIFRRQDVPKLQEYLKKHFR |
ORF Type | 3prime_partial |
Blastp | Lysine-specific demethylase JMJ25 from Arabidopsis with 56.17% of identity |
---|---|
Blastx | Lysine-specific demethylase JMJ25 from Arabidopsis with 51.29% of identity |
Eggnog | lysine (K)-specific demethylase(ENOG410XTAA) |
Kegg | Link to kegg annotations (AT3G07610) |
CantataDB | Link to cantataDB annotations (CNT0002033) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427793.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer