Protein coding transcript 109547

• Transcript: Ll_transcript_297066
• CDS coordinates: 1369-2304 (+)
• Peptide sequence: MDQVDWLPDSIGKLSSLVTLDLSENRIMALPSTIGGLSSLTRLDLHSNGITELPDSIGNLLSLVYLDLQGNQLSSLPASFGRLVRLQELDLSSNQISVLSDTIGSLVGLKVLSVETNDIEEIPHSIGNCSSLRELRADYNRLKALPEAVGKIQSLEILSLRYNNIKQLPTSMSSLINLKELNVSFNELESVPESLCFATSLVKLVIGNNFADMRSLPRSIGNLQMLEELDISNNQIYVLPDSFRMLSRLRVLRVEENPLEVPPRHIAEKGAQAVVQYMAELVEKREKKDVKPQQLKKKKSWTQFLLFSKKA*
• ORF Type: complete

Annotations of Ll_transcript_297066

• Blastp: Plant intracellular Ras-group-related LRR protein 4 from Arabidopsis with 74.03% of identity
• Blastx: Plant intracellular Ras-group-related LRR protein 4 from Arabidopsis with 72.32% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G35470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445149.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;