Transcript | Ll_transcript_295859 |
---|---|
CDS coordinates | 1004-1627 (+) |
Peptide sequence | MTEEKKTLRRKILAKWLKESILRLGPTFIKIGQQFSTRVDILPQEYVDQLSELQDQVPPFPSETAVAIIEEELGSPIDGIFDQFDYEPIAAASLGQVHRAKLKGQDVVVKVQRPGLKGLFDIDLKNLRVIAEYLQKVDPKSDGAKRDWVAIYDECASVLYQEIDYTKEATNAELFASNFKNMSYVKVPSIVWDYTTPQILTMEYVPGI |
ORF Type | 3prime_partial |
Blastp | Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic from Arabidopsis with 49.12% of identity |
---|---|
Blastx | Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic from Arabidopsis with 63.29% of identity |
Eggnog | Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661) |
Kegg | Link to kegg annotations (AT5G64940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462413.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer