Protein coding transcript 109565

• Transcript: Ll_transcript_295838
• CDS coordinates: 2535-3224 (+)
• Peptide sequence: MSYVKVPSIVWDYTTPQILTMEYVPGIKINKIQALDQLGVDRTRLGRYAVESYLEQILSHGFFHADPHPGNIAVDDVNGGRLIFYDFGMMGSISQNVREGLLETFYGVYEKDADKVLQAMIQMGVLVPTGDMTAVRRTAQFFLNSFEERLAAQRKERELAKAELGFKKPLSKEEKITKKKERLAAIGEDLLSIAADQPFRFPATFTFVVRAFSGKYCQVKRVTLHVLCM*
• ORF Type: complete

Annotations of Ll_transcript_295838

• Blastp: Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic from Arabidopsis with 54.23% of identity
• Blastx: Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic from Arabidopsis with 87.76% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT5G64940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462413.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;