Protein coding transcript 109671

• Transcript: Ll_transcript_294874
• CDS coordinates: 371-796 (+)
• Peptide sequence: MGVIQDKLLALYRSRWLVFVAAMWLQSWAGVGYLFGSISPIIKSSLNYNQKQVAMLGVAKNLGGCVGFITGVLCEILPIWGALLVGACLNLFGYGWVWLVVTGSVPTLPLWAVSTFYSSSFIWNVLIIKVNELEASLTFLF*
• ORF Type: complete

Annotations of Ll_transcript_294874

• Blastp: Protein NUCLEAR FUSION DEFECTIVE 4 from Arabidopsis with 35.79% of identity
• Blastx: Protein NUCLEAR FUSION DEFECTIVE 4 from Arabidopsis with 35.79% of identity
• Eggnog: Nodulin-like(ENOG41105RT)
• Kegg: Link to kegg annotations (AT1G31470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438651.1)
• Pfam: Nodulin-like (PF06813.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;