Protein coding transcript 109680

• Transcript: Ll_transcript_295992
• CDS coordinates: 209-895 (+)
• Peptide sequence: MQDPFSNPNSNPNPHNANAASQLPPPPPSTAAANSSSSSFFIRSGGNGGSLHRRSHSELSFRLPDDMMDLSPSDQFNGGSSTATFDEIGSEDDLFSTYIDVDKLGGSVASGGNGEPSEKNLNVRPRHRHSSSVDGSTSSFDEIMDAKKAMPPDKLAELWTIDPKRAKRILANRQSAARSKERKARYIQELERKVQTLQTEATTLSAQLTLYQVCVNIYLKLTALSLLQ*
• ORF Type: complete

Annotations of Ll_transcript_295992

• Blastp: Transcription factor RF2b from Oryza sativa with 47.15% of identity
• Blastx: bZIP transcription factor 18 from Arabidopsis with 59.56% of identity
• Eggnog: Transcription factor(ENOG410YGG3)
• Kegg: Link to kegg annotations (4332761)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432332.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;