Protein coding transcript 109684

• Transcript: Ll_transcript_295998
• CDS coordinates: 154-684 (+)
• Peptide sequence: MQDPSSNPNSNPLKANAASQLPPPPPSTAATTSSSSSFFIRSAGSGGSHHRRAHSEVSFRLPDDMMDLSPSDPFNGGSSAASFDEIGSEDDLFSTYIDVEKLGGSNGLGELGNGTDPCENGEPPEKNPSARPMHRHSNSVDGSTSPFGEIMDAKKAMPPDKLAELWTIDPKRAKRF*
• ORF Type: complete

Annotations of Ll_transcript_295998

• Blastp: bZIP transcription factor 18 from Arabidopsis with 53.62% of identity
• Blastx: Transcription factor RF2b from Oryza sativa with 46.38% of identity
• Eggnog: Transcription factor(ENOG410YGG3)
• Kegg: Link to kegg annotations (AT2G40620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455747.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;