Protein coding transcript 1097

• Transcript: Ll_transcript_435529
• CDS coordinates: 1-306 (+)
• Peptide sequence: DNEIKNFWNTHLKKKLIQMGFDPMTHQPRSDLVSTLPYLLALANITDTMDHNLSLDEQALGLTAEAVQLAKLQYLHYLLQTSNSLSTNNSYDQNAITNIEPF
• ORF Type: internal

Annotations of Ll_transcript_435529

• Blastp: Transcription factor MYB16 from Arabidopsis with 40.48% of identity
• Blastx: Transcription factor MYB102 from Arabidopsis with 72.73% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003523816.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;