Transcript | Ll_transcript_295642 |
---|---|
CDS coordinates | 1661-2197 (+) |
Peptide sequence | MYLLIVFLPLIGSSVAGFFGRFIGSEGTAIMTTTCVSFSSILSLIAFYEVALGASACYLRIAPWISSEMFDASWGFLFDSLTVVMLIVVTFISSLVHLYSISYMSEDPHSPRFMCYLSIFTFFMLMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLA |
ORF Type | 3prime_partial |
Blastp | Ribosomal protein S1, mitochondrial from Marchantia with 35.12% of identity |
---|---|
Blastx | NADH-ubiquinone oxidoreductase chain 5 from Triticum with 98.88% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431200.1) |
Pfam | - |
Rfam | Intron_gpII (RF00029) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer