Protein coding transcript 109733

• Transcript: Ll_transcript_295647
• CDS coordinates: 661-1080 (+)
• Peptide sequence: MGLTLYLGMKRGKIACHKSEARFGTLLREGRLASRASRDEAFWRSQVNFGPPNPATDEKALWSKGKRVRCHTPCLQKVPRGRAIRRKRRPGSGFPTGRGTGDGHLEAHHDLQARPARPGKATRLGVRGSIVPAAPRTSS*
• ORF Type: complete

Annotations of Ll_transcript_295647

• Blastp: Uncharacterized mitochondrial protein AtMg00660 from Arabidopsis with 56.14% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00660 from Arabidopsis with 74.67% of identity
• Eggnog: NA(ENOG410YMUZ)
• Kegg: Link to kegg annotations (ArthMp059)
• CantataDB: Link to cantataDB annotations (CNT0000014)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433151.1)
• Pfam: -
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;