Protein coding transcript 109785

• Transcript: Ll_transcript_296512
• CDS coordinates: 3-344 (+)
• Peptide sequence: KAATGAFIPDRVAVYCKCEMPYNPDDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCSECSSDDDLKKPQVTFPVSPASDSKLISVYTSIPIVGALNLQYNNSPMVNLFPVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_296512

• Blastp: Chromatin remodeling protein EBS from Arabidopsis with 80.43% of identity
• Blastx: Chromatin remodeling protein EBS from Arabidopsis with 80.43% of identity
• Eggnog: BAH domain and coiled-coil containing 1(ENOG410ZM6U)
• Kegg: Link to kegg annotations (AT4G22140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443895.1)
• Pfam: PHD-finger (PF00628.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;