Protein coding transcript 109811

• Transcript: Ll_transcript_297316
• CDS coordinates: 1607-2086 (+)
• Peptide sequence: MYLLRFIEYRISINFLTITLCCAYRYQIIRVHPTSLGENCKWLDMFEDTDTVLFSVSLSDYDEYTVDNNGVATNKMLAAKNLFEKIITHKAFSKKKFLLILTKFDLLEEKIEAVPLTRCEWFSDFNPVIGHNEKTSSSSSSRSSIVNNTNSPPLAQRAFQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_297316

• Blastp: Extra-large guanine nucleotide-binding protein 2 from Arabidopsis with 55.88% of identity
• Blastx: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 56.55% of identity
• Eggnog: Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ)
• Kegg: Link to kegg annotations (AT4G34390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448536.1)
• Pfam: G-protein alpha subunit (PF00503.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;