Protein coding transcript 109827

• Transcript: Ll_transcript_297336
• CDS coordinates: 2323-2961 (+)
• Peptide sequence: MGKSPAKWIKNVLFGKKSSKSNVSKGREKLVNQTEGVVPSKLSETGLALDPTPNINARNEEDPRLQDKEAENVLPGSQEIDTVESVQQDAPLDPEKIRLGEAATKAQAAFRGYLARRAFRALKGIIRLQALIRGHLVRRQAVATLCSVYGIVKLQALVRGRRVRLSEVGFEIHQKCTLLKPLVMFVKNHFLCNLSLNCHIIILFMLFLSWSN*
• ORF Type: complete

Annotations of Ll_transcript_297336

• Blastp: Protein IQ-DOMAIN 31 from Arabidopsis with 51.03% of identity
• Blastx: Protein IQ-DOMAIN 31 from Arabidopsis with 51.03% of identity
• Eggnog: IQ-domain(ENOG410YAVA)
• Kegg: Link to kegg annotations (AT1G74690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463745.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;