Protein coding transcript 109832

• Transcript: Ll_transcript_297330
• CDS coordinates: 2323-2961 (+)
• Peptide sequence: MGKSPAKWIKNVLFGKKSSKSNVSKGREKLVNQTEGVVPSKLSETGLALDPTPNINARNEEDPRLQDKEAENVLPGSQEIDTVESVQQDAPLDPEKIRLGEAATKAQAAFRGYLARRAFRALKGIIRLQALIRGHLVRRQAVATLCSVYGIVKLQALVRGRRVRLSEVGFEIHQKCTLLKPLVMFVKNHFLCNLSLNCHIIILFMLFLSWSN*
• ORF Type: complete

Annotations of Ll_transcript_297330

• Blastp: Protein IQ-DOMAIN 31 from Arabidopsis with 56.25% of identity
• Blastx: Protein IQ-DOMAIN 31 from Arabidopsis with 51.03% of identity
• Eggnog: IQ-domain(ENOG410YAVA)
• Kegg: Link to kegg annotations (AT1G74690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463745.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;